PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN24977.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 224aa    MW: 25619 Da    PI: 9.7837
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN24977.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.92.4e-50141391128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kg 97 
                 lppGfrFhPtdeelv +yLk+kv + +l++ ++i+e++++k++PwdLp      e+e yfFs++  ky++g+r+nrat+sgyWkatg dk+++++  ++
  KHN24977.1  14 LPPGFRFHPTDEELVLQYLKRKVFSCPLPA-SIIPELHVCKSDPWDLPGD---LEQERYFFSTKVAKYPNGNRSNRATNSGYWKATGLDKQIVTSkgNN 108
                 79****************************.89***************54...46799***********************************997777 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 ++vg+kktLvfy+g+ p+g++tdW+mheyrl
  KHN24977.1 109 QVVGMKKTLVFYRGKPPNGSRTDWIMHEYRL 139
                 88***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-5910164IPR003441NAC domain
PROSITE profilePS5100556.3814164IPR003441NAC domain
PfamPF023654.1E-2715139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MEKVNFVKNG ELRLPPGFRF HPTDEELVLQ YLKRKVFSCP LPASIIPELH VCKSDPWDLP  60
GDLEQERYFF STKVAKYPNG NRSNRATNSG YWKATGLDKQ IVTSKGNNQV VGMKKTLVFY  120
RGKPPNGSRT DWIMHEYRLI LNASQSQSHV VPMENWVLCR IFLKRRIGAK NGEESNSKVV  180
FYDFLAQNKT DSSSSVASGI THESDEHEES SSSNTFPYTI RRKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-501116514166NAC domain-containing protein 19
4dul_A3e-501116514166NAC domain-containing protein 19
1ut7_B3e-501116514166NO APICAL MERISTEM PROTEIN
1ut7_A3e-501116514166NO APICAL MERISTEM PROTEIN
1ut4_B3e-501116514166NO APICAL MERISTEM PROTEIN
1ut4_A3e-501116514166NO APICAL MERISTEM PROTEIN
3swp_D3e-501116517169NAC domain-containing protein 19
3swp_C3e-501116517169NAC domain-containing protein 19
3swp_B3e-501116517169NAC domain-containing protein 19
3swp_A3e-501116517169NAC domain-containing protein 19
3swm_D3e-501116517169NAC domain-containing protein 19
3swm_C3e-501116517169NAC domain-containing protein 19
3swm_B3e-501116517169NAC domain-containing protein 19
3swm_A3e-501116517169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0899630.0BT089963.1 Soybean clone JCVI-FLGm-3C16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001238630.11e-169NAC domain protein
SwissprotQ9FY933e-95NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A0B2QZ841e-169A0A0B2QZ84_GLYSO; NAC domain-containing protein 29
TrEMBLI1KZG01e-169I1KZG0_SOYBN; Uncharacterized protein
STRINGGLYMA08G47520.11e-169(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.12e-94NAC domain containing protein 83
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]